Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable cytochrome c oxidase subunit 2 (ctaC)

This Recombinant Probable cytochrome c oxidase subunit 2 (ctaC) spans the amino acid sequence from region 40-360.

Product Specifications

Product Name Alternative

Probable cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome aa3 subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q73YL5

Expression Region

40-360

Origin

Mycobacterium paratuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IVLSGCSSWADALALGWPKGITPQAHLNRELWIGAVIASLVVGAIVYGLIFWASAFHRKK ATDTELPRQFGYNMPLELVLTVTPFLIISVLFYFTVVVQEKMLHIAKDPEVVVDVTAFQW NWKFGYQKVNFKDGTLTYDGADPERKKAMVSKPEGKDAHGEERVGAVRGLNTSDRTYLNF DKVETLGSSDEIPVLVLPTGKRIEFDLASADVVHTFWVPEFLFKRDVIPNAEANNSIHVF QVEEINSPGAFVGHCAEFCGTYHSMMNFEVRVVSPNDFKAYLQQRMDGKSNAEALQAIGQ SPVAVTTHPFDSKRGQLAGSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-500 1x 500 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL
BNC880003-100 1x 100 µL

CD45RO (UCHL-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF647 conjugate, 0.1mg/mL
BNC471052-100 1x 100 µL

CD3e (B-B12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF594 conjugate, 0.1mg/mL
BNC941045-100 1x 100 µL

CD16 (C16/1045), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details