Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Magnesium transport protein CorA (corA)

This Recombinant Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-321.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7M9C0

Expression Region

1-321

Origin

Wolinella succinogenes

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNIFTKREGLVLRESFSSIQTPHSTSNVLWIDLLHPSPAEVSYISQIFHLDIPTKEERE EIEQSARYWEDSESITINTYFLVSLFASTNKKDLHNETVTFLLCKDILFTIRYGEFRTFD EIQNKVLASPKNFQNGYDILSKIFEIRVEQDADMLENTAKDTRGLRSGVFGNQFGYDELL ENLSRLQELNMRIRDSLFDKRRAITALLKTDKADIEVKKNLTIVLKDLNSLVEFTTVNMN ALDNIQSLFSSQINIEQNKTIKIFTVATVGFMPPTLIASIYGMNFDVMPELHWEWGYPLT LCLMVISTMIPILYFKKKKWL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LENG1 activation kit by CRISPRa
GA112396 1 Kit

Human LENG1 activation kit by CRISPRa

Sign In for Pricing
View Details
CHEK1 Polyclonal Antibody
E-AB-62039-01 60 µL

CHEK1 Polyclonal Antibody

Sign In for Pricing
View Details
CHEK1 Polyclonal Antibody
E-AB-62039-02 120 µL

CHEK1 Polyclonal Antibody

Sign In for Pricing
View Details
CHEK1 Polyclonal Antibody
E-AB-62039-03 200 µL

CHEK1 Polyclonal Antibody

Sign In for Pricing
View Details
Bicyclo[4.1.0]heptane-7-carboxylic Acid
TRC-C986323-500MG 500 mg

Bicyclo[4.1.0]heptane-7-carboxylic Acid

Sign In for Pricing
View Details