Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

This Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, EC= 2.7.8.30, Undecaprenyl-phosphate Ara4FN transferase, Ara4FN transferase

UniProt

B7LAR9

Expression Region

1-322

Origin

Escherichia coli (strain 55989 / EAEC)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT DVRARPRYFVQQVIRPSSKENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL
BNC040437-500 1x 500 µL

CD47 (B6H12.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF405S conjugate, 0.1mg/mL
BNC041553-100 1x 100 µL

MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF594 conjugate, 0.1mg/mL
BNC941927-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details