Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

This Recombinant Escherichia coli Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, EC= 2.7.8.30, Undecaprenyl-phosphate Ara4FN transferase, Ara4FN transferase

UniProt

B1X8W7

Expression Region

1-322

Origin

Escherichia coli (strain K12 / DH10B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFEIHPVKKVSVVIPVYNEQESLPELIRRTTTACESLGKEYEILLIDDGSSDNSAHMLVE ASQAENSHIVSILLNRNYGQHSAIMAGFSHVTGDLIITLDADLQNPPEEIPRLVAKADEG YDVVGTVRQNRQDSWFRKTASKMINRLIQRTTGKAMGDYGCMLRAYRRHIVDAMLHCHER STFIPILANIFARRAIEIPVHHAEREFGESKYSFMRLINLMYDLVTCLTTTPLRMLSLLG SIIAIGGFSIAVLLVILRLTFGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYT DVRARPRYFVQQVIRPSSKENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
BNC040043-100 1x 100 µL

P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL
BNC681003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-100 1x 100 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF594 conjugate, 0.1mg/mL
BNC942967-500 1x 500 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (COL-1 + CEA31 + C66/261), CF640R conjugate, 0.1mg/mL
BNC400747-100 1x 100 µL

CD66 (CEA) (COL-1 + CEA31 + C66/261), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details