Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter hepaticus Magnesium transport protein CorA (corA)

This Recombinant Helicobacter hepaticus Magnesium transport protein CorA (corA) spans the amino acid sequence from region 1-322.

Product Specifications

Product Name Alternative

Magnesium transport protein CorA

UniProt

Q7VFJ7

Expression Region

1-322

Origin

Helicobacter hepaticus (strain ATCC 51449 / 3B1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINIFIRRGGLIVRESLYSSDEQIKVFHEEDKILWIDLFRPSSDEVNYISQTYHLEVPTK EEREEIEQSARYWEDSGSITINTYFLVRSLESELHNETITFLLRKNILFTIRYSEFRVFD EIQQIVLATPKVFEDGFDLIGKIFEIRVEKDADLLESAAKNTRALRKRVFNSQVINYDEM LEELSSLQELNMSVRDSLFDKRRAITAVLKSDKADADVKKNITIVLKDLNSLVEFTAVNM HALDNIQTILTNQINIEQNKTIKLFTVVTVAMMPPTLIGTIYGMNFDNMPELHWDFSYPV ALVIMILSTIFPIIYFKKKGWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL
BNC040861-500 1x 500 µL

HSP27 (G3.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL
BNC880050-100 1x 100 µL

IgA Secretory Component (SC05), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details