Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2 (mcr1)

This Recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2 (mcr1) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 2, EC= 1.6.2.2, Mitochondrial cytochrome b reductase

UniProt

Q2UKB8

Expression Region

1-323

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFARQTFRCAQPLRQSFRKYSTEAPKAKSLAPIYTAVGLTGLSVGLYRYYYGAGATAEAP VERAKVFTGGDQGWVDLKLSEIEVLSHNTKRLRFEFEDKEAVSGVTIASALLTKFKPVGA EKAVLRPYTPTSDEDQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLSFKGPLPKYQWETNK HEHIALIAGGTGITPMYQLIRQIFKNPDDKTKVTLVYGNVTEDDILLKKELQDLENTYPQ RFKAFYLLDKPPKEWTGGKGYINKELLKTVLPEPKEENQKIFVCGPPGLYNAVSGNKVSP KDQGELSGILKELGYNKDQVYKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL
BNC470012-500 1x 500 µL

Tyrosinase (T311), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details