Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BGLAP, Rat (GST)

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

BGLAP Protein, Rat (GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bglap-protein-rat-gst.html

Purity

90.00

Smiles

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Molecular Formula

25295 (Gene_ID) P04640 (Y50-V99) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLIT2-IT1 Protein Vector (Human) (pPB-N-His)
PV130279 500 ng

SLIT2-IT1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
2-Chlorobenzene-1-carboximidamide hydrochloride
OR311150-01 250 mg

2-Chlorobenzene-1-carboximidamide hydrochloride

Sign In for Pricing
View Details
2-Chlorobenzene-1-carboximidamide hydrochloride
OR311150-02 1 g

2-Chlorobenzene-1-carboximidamide hydrochloride

Sign In for Pricing
View Details
2-Chlorobenzene-1-carboximidamide hydrochloride
OR311150-03 5 g

2-Chlorobenzene-1-carboximidamide hydrochloride

Sign In for Pricing
View Details
Eukaryotic Intercellular Adhesion Molecule 2 (ICAM2)
MBS2162512-01 0.01 mg

Eukaryotic Intercellular Adhesion Molecule 2 (ICAM2)

Sign In for Pricing
View Details
Eukaryotic Intercellular Adhesion Molecule 2 (ICAM2)
MBS2162512-02 0.05 mg

Eukaryotic Intercellular Adhesion Molecule 2 (ICAM2)

Sign In for Pricing
View Details