BGLAP, Rat (GST)
BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
BGLAP Protein, Rat (GST), Rat, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bglap-protein-rat-gst.html
Purity
90.00
Smiles
YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Molecular Formula
25295 (Gene_ID) P04640 (Y50-V99) (Accession)
Molecular Weight
Approximately 32.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-13951-20ug 20 µg
Rabbit Monoclonal IL-15 Antibody (IL15/6971R)
Sign In for Pricing
View Details GTR15218910 1 Vial
Lentiviral mouse Gm3404 shRNA (UAS) - Lentiviral mouse Gm3404 shRNA (UAS) (100)
Sign In for Pricing
View Details 122793-APC 100 µL
ABCA10 (ATP-binding Cassette Sub-family A Member 10) (APC)
Sign In for Pricing
View Details bs-9660R-PE-Cy5.5 100 µL
ENAH Polyclonal Antibody, PE-Cy5.5 Conjugated
Sign In for Pricing
View Details MBS2075210-01 0.1 mL
PE-Linked Polyclonal Antibody to Tubulin Epsilon (TUBe)
Sign In for Pricing
View Details MBS2075210-02 0.2 mL
PE-Linked Polyclonal Antibody to Tubulin Epsilon (TUBe)
Sign In for Pricing
View Details