Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BGLAP, Rat (GST)

BGLAP protein in its carboxylated form negatively regulates bone formation while promoting bone resorption and mineralization.The carboxylated form has a strong affinity for apatite and calcium.BGLAP Protein, Rat (GST) is the recombinant rat-derived BGLAP protein, expressed by E.coli , with N-GST labeled tag.

Product Specifications

Product Name Alternative

BGLAP Protein, Rat (GST), Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bglap-protein-rat-gst.html

Purity

90.00

Smiles

YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV

Molecular Formula

25295 (Gene_ID) P04640 (Y50-V99) (Accession)

Molecular Weight

Approximately 32.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine c-Jun N-terminal kinases (JNK) ELISA Kit
YP-W80522-01 48 Tests

Porcine c-Jun N-terminal kinases (JNK) ELISA Kit

Sign In for Pricing
View Details
Porcine c-Jun N-terminal kinases (JNK) ELISA Kit
YP-W80522-02 96 Tests

Porcine c-Jun N-terminal kinases (JNK) ELISA Kit

Sign In for Pricing
View Details
Bex2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3375708 1.0 µg DNA

Bex2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
PDGFB antibody
70R-30717 100 ug

PDGFB antibody

Sign In for Pricing
View Details
Slc22a7 Rat Pre-designed siRNA Set A
HY-RS28553 1 Set

Slc22a7 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD3e (AP) discontinued
C2254-61-AP 100 µL

CD3e (AP) discontinued

Sign In for Pricing
View Details