Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis ComG operon protein 2 (comGB)

This Recombinant Bacillus subtilis ComG operon protein 2 (comGB) spans the amino acid sequence from region 1-323.

Product Specifications

Product Name Alternative

ComG operon protein 2

UniProt

P25954

Expression Region

1-323

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAGGYTLLDGLRLMELQMNKRQAADLTDSVTCLREGAPFYQVLKSLSFHKEAVGICYFA ETHGELPASMIQSGELLERKIAQADQLKRVLRYPLFLIFTVAVMFYMLQSIIIPQFSGIY QSMNMETSRSTDMLFAFFQHIDLVIILLVLFTAGIGIYYWLVFKKKSPARQMLICIRIPL VGKLVKLFNSYFFSLQLSSLLKSGLSIYDSLNAFKHQTFLPFYRCEAEQLIERLKAGESI ESAICGSLFYETDLSKVISHGQLSGRLDRELFTYSQFILQRLEHKAQKWTGILQPMIYGF VAAMILLVYLSMLVPMYQMMNQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cluster of differentiation 26, CD26 ELISA Kit
MBS165376-01 48 Well

Human cluster of differentiation 26, CD26 ELISA Kit

Sign In for Pricing
View Details
Human cluster of differentiation 26, CD26 ELISA Kit
MBS165376-02 96 Well

Human cluster of differentiation 26, CD26 ELISA Kit

Sign In for Pricing
View Details
Human cluster of differentiation 26, CD26 ELISA Kit
MBS165376-03 5x 96 Well

Human cluster of differentiation 26, CD26 ELISA Kit

Sign In for Pricing
View Details
Human cluster of differentiation 26, CD26 ELISA Kit
MBS165376-04 10x 96 Well

Human cluster of differentiation 26, CD26 ELISA Kit

Sign In for Pricing
View Details
EXT1 siRNA (Human)
orb1866776-01 15 nmol

EXT1 siRNA (Human)

Sign In for Pricing
View Details
EXT1 siRNA (Human)
orb1866776-02 30 nmol

EXT1 siRNA (Human)

Sign In for Pricing
View Details