Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spinacia oleracea 37 kDa inner envelope membrane protein, chloroplastic

This Recombinant Spinacia oleracea 37 kDa inner envelope membrane protein, chloroplastic spans the amino acid sequence from region 22-344.

Product Specifications

Product Name Alternative

37 kDa inner envelope membrane protein, chloroplastic, E37

UniProt

P23525

Expression Region

22-344

Origin

Spinacia oleracea (Spinach)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RLRFSGSDFTGSYKLPRLNLPPNSRNLRAKTLTTVTKCTLSASERPASQPRFIQNKQEAF WFYRFLSIVYDNIINPGHWTEDMRDVALEPADLNNRNMLVVDVGGGTGFTTLGIIKHVDP KNVTILDQSPHQLAKAKAKKPLKECRIIEGDAEDLPFPTDYADRYVSAGSIEYWPDPQRG IREAYRVLKLGGKACLIGPVYPTFWLSRFFADVWMLFPKEEEYIEWFQKAGFKDVQLKRI GPKWYRGVRRHGLIMGCSVTGVKPASGDSPLQLGPKVEDVQKPVHPLVFLYRFLLGALAS TYYVLVPIYMWIKDKIFPKGMPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Set, HisTekTM, DNA, RNA, Protein, Human Adult Normal, Adipose discontinued
T5595-0005V 1 Kit

Tissue Set, HisTekTM, DNA, RNA, Protein, Human Adult Normal, Adipose discontinued

Sign In for Pricing
View Details
Anti-SHIP1 (Rabbit, Polyclonal)
A120972 100 µL

Anti-SHIP1 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
Thymidine Kinase 2 (TK2) (NM_004614) Human Untagged Clone
SC317459 10 µg

Thymidine Kinase 2 (TK2) (NM_004614) Human Untagged Clone

Sign In for Pricing
View Details
Polyclonal Antibody to Thyroid Peroxidase (TPO)
MBS2001549-01 0.1 mL

Polyclonal Antibody to Thyroid Peroxidase (TPO)

Sign In for Pricing
View Details
Polyclonal Antibody to Thyroid Peroxidase (TPO)
MBS2001549-02 0.2 mL

Polyclonal Antibody to Thyroid Peroxidase (TPO)

Sign In for Pricing
View Details
Polyclonal Antibody to Thyroid Peroxidase (TPO)
MBS2001549-03 0.5 mL

Polyclonal Antibody to Thyroid Peroxidase (TPO)

Sign In for Pricing
View Details