Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ustilago maydis NADH-cytochrome b5 reductase 1 (CBR1)

This Recombinant Ustilago maydis NADH-cytochrome b5 reductase 1 (CBR1) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 1, EC= 1.6.2.2, Microsomal cytochrome b reductase

UniProt

Q4PGW7

Expression Region

1-324

Origin

Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVLIEQVVLVASILITFGTCLAATKYAARLFPHFEPLQFYDEATNPMELNIVLAFVVGLI GSVVVLLYFDSQKIKPVLNPTQWQQYRLMEKQKLSDNTALYRFKLPRSNNILGLPIGQHI SVQANMGGKTVVRSYTPTSSDDDHGFFDLVVKSYEQGNVSKYIGSMKIGDLLSVKGPKGQ MRYAPGLSRHIGMIAGGTGLTPCLQIIRAALKNPADKTQIDFIYANVKETDILLKDELDE LALKHKDQFRISYFLNEAPEGWKGGVGFVTKEALEKNLPKPANDIKVLMCGPPPMIKAMT GHLEALGYEKPRTVSKLEDQVFCF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF647 conjugate, 0.1mg/mL
BNC470871-100 1x 100 µL

CD71 (66IG10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-100 1x 100 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF488A conjugate, 0.1mg/mL
BNC880871-500 1x 500 µL

CD71 (66IG10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL
BNC041037-500 1x 500 µL

CD44 Standard (DF1485), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF405M conjugate, 0.1mg/mL
BNC052349-100 1x 100 µL

MUC16 / CA125 (Ovarian Carcinoma Marker) (OCA125/2349R), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF647 conjugate, 0.1mg/mL
BNC471981-500 1x 500 µL

Elastin (ELN) (Marker of Arterial Stiffness and Atherosclerosis) (ELN/1981), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details