Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Protease HtpX homolog (htpX)

This Recombinant Brucella abortus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

B2S7N7

Expression Region

1-325

Origin

Brucella abortus (strain S19)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF405S conjugate, 0.1mg/mL
BNC040449-500 1x 500 µL

CD104 (UM-A9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-500 1x 500 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL
BNC402897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL
BNC741593-500 1x 500 µL

Aurora B (Proliferation Marker) (AURKB/1593), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF488A conjugate, 0.1mg/mL
BNC882984-500 1x 500 µL

Nuclear Antigen (Pan-Nuclear Marker) (NM2984R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details