Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 4 (GRA4)

This Recombinant Dense granule protein 4 (GRA4) spans the amino acid sequence from region 21-345.

Product Specifications

Product Name Alternative

Dense granule protein 4, Protein GRA 4, Antigen H11

UniProt

Q27002

Expression Region

21-345

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GECSFGSHLADMAGLSGRHDKERHQAKKRYYHSMYGNQTPYPYANGQQASPPPQGQLLII QNPDGSFMIVDQQGVPQVPQAAGGPGSPMNGGYYMPTGVYTAQVVPGTPGHPVQAIPQQP LRTQATATYYHPAAVPPPGPSVFVFTPSSVQPGAEVTPGYSGLQLRQQSQYGYSYPGTTS TPTPPPPASYGYPVFPAFPRLPAFSDSVSVSTEDSGLTGVKDSSSSESTVTPADEAASES EEGDKTSRKSKVKKGILTGLGVAATLAAAAAAAKAVKGFGGTRTSTAPAEAGKTELDDGY RPPPFNPRPSPYAELLKDLERMRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Egr-2 Rabbit Polyclonal Antibody
E53P03694 100 µL

Egr-2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal COX-2 Antibody (COX2/7803R) [PerCP]
NBP3-21139PCP 0.1 mL

Rabbit Monoclonal COX-2 Antibody (COX2/7803R) [PerCP]

Sign In for Pricing
View Details
Human Matrix metalloproteinase 2/Gelatinase A,MMP-2 ELISA kit
CN-03224H2 48T

Human Matrix metalloproteinase 2/Gelatinase A,MMP-2 ELISA kit

Sign In for Pricing
View Details
SLC1A2 sgRNA CRISPR Lentivector set (Human)
K2155301 3x 1.0 µg

SLC1A2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Apc11 (ANAPC11) Mouse Monoclonal Antibody [Clone ID: OTI3C4]
TA506325S 30 µL

Apc11 (ANAPC11) Mouse Monoclonal Antibody [Clone ID: OTI3C4]

Sign In for Pricing
View Details
PerCP/Cy5.5 Anti-human CD16 Antibody *3G8*
101611U1-AAT 100 Tests

PerCP/Cy5.5 Anti-human CD16 Antibody *3G8*

Sign In for Pricing
View Details