Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dense granule protein 4 (GRA4)

This Recombinant Dense granule protein 4 (GRA4) spans the amino acid sequence from region 21-345.

Product Specifications

Product Name Alternative

Dense granule protein 4, Protein GRA 4, Antigen H11

UniProt

Q27002

Expression Region

21-345

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GECSFGSHLADMAGLSGRHDKERHQAKKRYYHSMYGNQTPYPYANGQQASPPPQGQLLII QNPDGSFMIVDQQGVPQVPQAAGGPGSPMNGGYYMPTGVYTAQVVPGTPGHPVQAIPQQP LRTQATATYYHPAAVPPPGPSVFVFTPSSVQPGAEVTPGYSGLQLRQQSQYGYSYPGTTS TPTPPPPASYGYPVFPAFPRLPAFSDSVSVSTEDSGLTGVKDSSSSESTVTPADEAASES EEGDKTSRKSKVKKGILTGLGVAATLAAAAAAAKAVKGFGGTRTSTAPAEAGKTELDDGY RPPPFNPRPSPYAELLKDLERMRKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mustn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4092208 1.0 µg DNA

Mustn1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
POLR2J2 Antibody (YA8452, Mouse)
HY-P88768 1 Each

POLR2J2 Antibody (YA8452, Mouse)

Sign In for Pricing
View Details
EF-G2 (E-10) FITC
sc-514242 FITC 200 µg/mL

EF-G2 (E-10) FITC

Sign In for Pricing
View Details
Recombinant Human SFRP2 Protein, C-His
EHK84801 100 μg

Recombinant Human SFRP2 Protein, C-His

Sign In for Pricing
View Details
HA1 (H14N5) (A/mallard/Astrakhan/263/1982)
IT-003-015p-01 0.1 mg

HA1 (H14N5) (A/mallard/Astrakhan/263/1982)

Sign In for Pricing
View Details
HA1 (H14N5) (A/mallard/Astrakhan/263/1982)
IT-003-015p-02 1 mg

HA1 (H14N5) (A/mallard/Astrakhan/263/1982)

Sign In for Pricing
View Details