Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella abortus Protease HtpX homolog (htpX)

This Recombinant Brucella abortus Protease HtpX homolog (htpX) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Protease HtpX homolog, EC= 3.4.24.-

UniProt

Q2YLH3

Expression Region

1-325

Origin

Brucella abortus (strain 2308)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL
BNC680204-500 1x 500 µL

Complement C4d (C4D204), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-500 1x 500 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL
BNC740008-100 1x 100 µL

MAGE A1 (MA454), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details