Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Serine protease HTRA2, mitochondrial (HTRA2)

This Recombinant Bovine Serine protease HTRA2, mitochondrial (HTRA2) spans the amino acid sequence from region 134-458.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108

UniProt

A0JNK3

Expression Region

134-458

Origin

Bos taurus (Bovine)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLPSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPAKDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTSGISFAIPSDRLREFLHRGEKKNSWFGISGSQRRYIGVMMLTLTPSI LAELQLREPSFPDVQHGVLIHKVILDSPAHRAGLRPGDVILAIGEQLVQNAEDIYEAVRT QSQLAVRIRRGQETLTLYVTPEVTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL
BNC041003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-100 1x 100 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-100 1x 100 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF488A conjugate, 0.1mg/mL
BNC880164-500 1x 500 µL

CD28 (204.12), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details