Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease HTRA2, mitochondrial (HTRA2)

This Recombinant Human Serine protease HTRA2, mitochondrial (HTRA2) spans the amino acid sequence from region 134-458.

Product Specifications

Product Name Alternative

Serine protease HTRA2, mitochondrial, EC= 3.4.21.108, High temperature requirement protein A2, HtrA2, Omi stress-regulated endoprotease, Serine protease 25, Serine proteinase O

UniProt

O43464

Expression Region

134-458

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLI VTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRRYIGVMMLTLSPSI LAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQMVQNAEDVYEAVRT QSQLAVQIRRGRETLTLYVTPEVTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAB1 (NM_006116) Human Recombinant Protein
TP308522L 1 mg

TAB1 (NM_006116) Human Recombinant Protein

Sign In for Pricing
View Details
Gamma-CEHC-d5
TRC-C249202-10MG 10 mg

Gamma-CEHC-d5

Sign In for Pricing
View Details
Tissue Total RNA, Ovary
CR561404 5 µg

Tissue Total RNA, Ovary

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802M1-01 20 Tests

Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802M1-02 100 Tests

Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802M1-03 2x 100 Tests

Elab Fluor® 700 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details