Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Peptidoglycan-binding protein ArfA (arfA)

This Recombinant Peptidoglycan-binding protein ArfA (arfA) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Peptidoglycan-binding protein ArfA, Outer membrane porin A, Outer membrane protein A, OmpATb, Outer membrane protein ArfA

UniProt

P65593

Expression Region

1-326

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RED Antibody
MBS8515056-01 0.1 mg

RED Antibody

Sign In for Pricing
View Details
RED Antibody
MBS8515056-02 0.1 mL (AF635)

RED Antibody

Sign In for Pricing
View Details
RED Antibody
MBS8515056-03 0.1 mL (AF610)

RED Antibody

Sign In for Pricing
View Details
RED Antibody
MBS8515056-04 0.1 mL (AF405S)

RED Antibody

Sign In for Pricing
View Details
RED Antibody
MBS8515056-05 0.1 mL (AF405L)

RED Antibody

Sign In for Pricing
View Details
RED Antibody
MBS8515056-06 0.1 mL (AF546)

RED Antibody

Sign In for Pricing
View Details