Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Peptidoglycan-binding protein ArfA (arfA)

This Recombinant Peptidoglycan-binding protein ArfA (arfA) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Peptidoglycan-binding protein ArfA, Outer membrane protein ArfA

UniProt

P65594

Expression Region

1-326

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Map3k1 3'UTR Luciferase Stable Cell Line
TU212823 1.0 mL

Map3k1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LY6D Human
PT-A03400-01 5 µg

LY6D Human

Sign In for Pricing
View Details
LY6D Human
PT-A03400-02 20 µg

LY6D Human

Sign In for Pricing
View Details
LY6D Human
PT-A03400-03 1 mg

LY6D Human

Sign In for Pricing
View Details
Cd27 Rabbit Polyclonal Antibody (Fluoro488)
orb3115189 100 µg

Cd27 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
FAKD5 Peptide
DF8845-BP 1 mg

FAKD5 Peptide

Sign In for Pricing
View Details