Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Peptidoglycan-binding protein ArfA (arfA)

This Recombinant Peptidoglycan-binding protein ArfA (arfA) spans the amino acid sequence from region 1-326.

Product Specifications

Product Name Alternative

Peptidoglycan-binding protein ArfA, Outer membrane protein ArfA

UniProt

P65594

Expression Region

1-326

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPT GVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDEAAKAALMTALNGLLAPGVNV IDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAAT STWPDMKIVNNIEVTGQAPPGPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEIL NRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL GSVNPIASNATPEGRAKNRRVEIVVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Iduronate-2-Sulfatase (IDS) ELISA Kit
MBS268860-01 48 Well

Rat Iduronate-2-Sulfatase (IDS) ELISA Kit

Sign In for Pricing
View Details
Rat Iduronate-2-Sulfatase (IDS) ELISA Kit
MBS268860-02 96 Well

Rat Iduronate-2-Sulfatase (IDS) ELISA Kit

Sign In for Pricing
View Details
Rat Iduronate-2-Sulfatase (IDS) ELISA Kit
MBS268860-03 5x 96 Well

Rat Iduronate-2-Sulfatase (IDS) ELISA Kit

Sign In for Pricing
View Details
Rat Iduronate-2-Sulfatase (IDS) ELISA Kit
MBS268860-04 10x 96 Well

Rat Iduronate-2-Sulfatase (IDS) ELISA Kit

Sign In for Pricing
View Details
1,6-Heptadiene 99%
H01050-01 1 mL

1,6-Heptadiene 99%

Sign In for Pricing
View Details
1,6-Heptadiene 99%
H01050-02 5 mL

1,6-Heptadiene 99%

Sign In for Pricing
View Details