Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Micronemal protein 6 (MIC6)

This Recombinant Micronemal protein 6 (MIC6) spans the amino acid sequence from region 24-349.

Product Specifications

Product Name Alternative

Micronemal protein 6

UniProt

Q9XYH7

Expression Region

24-349

Origin

Toxoplasma gondii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SPFFAFLPGNGEIADNCSGNPCGGTAAGTCINTPSGYDCRCEPGYVLGVENDQVTCMMPS GVPMANFVQLSETPAACSSNPCGPEAAGTCKETNSGYICRCNQGYRISLDGTGNVTCIVR QESGCEENGCGPPDAVQSCRRLTGTAGRLCVCKENFIATIDASAHITCKRVPPHYRKPPF EFGKGGHPVDSEPSKRQREDEGESREPESDSTEPGRDQERRTPLEESQEPEGSTPDSQQS RGGSGSDSTESEEQGKEREEGSGHAGAIAGGVIGGLLLLSAAGAGVAYMRKSGSGGGEEI EYERGIEAAEASEVEVLVDLDSKTWD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL31 (N-term) Rabbit Polyclonal Antibody
AP52198PU-N 400 µL

IL31 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GRB10 (NM_001001550) Human Recombinant Protein
TP320822L 1 mg

GRB10 (NM_001001550) Human Recombinant Protein

Sign In for Pricing
View Details
PSMD4 (NM_002810) Human Over-expression Lysate
LC400997 20 µg

PSMD4 (NM_002810) Human Over-expression Lysate

Sign In for Pricing
View Details
CD33 (C33/69), CF647 conjugate, 0.1mg/mL
BNC470069-500 1x 500 µL

CD33 (C33/69), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD2AP Antibody (Biotin)
KB-8220-01 50 μL

CD2AP Antibody (Biotin)

Sign In for Pricing
View Details
CD2AP Antibody (Biotin)
KB-8220-02 100 µL

CD2AP Antibody (Biotin)

Sign In for Pricing
View Details