Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella dublin Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

This Recombinant Salmonella dublin Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, EC= 2.7.8.30, Undecaprenyl-phosphate Ara4FN transferase, Ara4FN transferase

UniProt

B5FNT8

Expression Region

1-327

Origin

Salmonella dublin (strain CT_02021853)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTPFTEESHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF488A conjugate, 0.1mg/mL
BNC881628-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP9 (rMMP9/1769), CF405S conjugate, 0.1mg/mL
BNC042176-100 1x 100 µL

MMP9 (rMMP9/1769), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details