Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC)

This Recombinant Salmonella paratyphi A Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase (arnC) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase, EC= 2.7.8.30, Undecaprenyl-phosphate Ara4FN transferase, Ara4FN transferase

UniProt

B5BCP7

Expression Region

1-327

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDAAPIKKVSVVIPVYNEQESLPELIRRTTAACESLGKAWEILLIDDGSSDSSAELMVK ASQEADSHIISILLNRNYGQHAAIMAGFSHVSGDLIITLDADLQNPPEEIPRLVAKADEG FDVVGTVRQNRQDSLFRKSASKIINLLIQRTTGKAMGDYGCMLRAYRRPIIDTMLRCHER STFIPILANIFARRATEIPVHHAEREFGDSKYSFMRLINLMYDLVTCLTTTPLRLLSLLG SVIAIGGFSLSVLLIVLRLALGPQWAAEGVFMLFAVLFTFIGAQFIGMGLLGEYIGRIYN DVRARPRYFVQQVIYPESTSFTEESHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL
BNC680500-100 1x 100 µL

Progesterone Receptor (PR500), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-500 1x 500 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL
BNC470775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details