Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T25D10.1 (T25D10.1)

This Recombinant Uncharacterized protein T25D10.1 (T25D10.1) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Uncharacterized protein T25D10.1

UniProt

Q10017

Expression Region

1-327

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLRRRNLNSSRIICIISIIVLLLIIISLYPHKRTQFGRYSRRQKTIRFQHSTGEIGDQL FSLLSHLGVAKTLYRIPVINSANNSKLIDTLSNAMFTRFPSILQQFLIAIEPPTAVNREL GIENSSYEDPLTKFSEDTSSSLMVKGNGFKSFKYFDNLRSDIRLWVLEDAESVLEAQNLI TKSQRNNFKICVHATLESNKNCSVKAIAQILNHYTNEYEDVMLIIASPFPEFTRFIFTNS RIRKYKTEKFSLISSSPEMQIIFSRIYCDVVFLTVPYSTHGWWMGYLAKDDNSHVFYFDP DMFPKNRTANQEDYFPPKWKKLSRKIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
orb1948267-01 48 Tests

Rat Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details
Rat Regenerating Islet Derived Protein 4 (REG4) ELISA Kit
orb1948267-02 96 Tests

Rat Regenerating Islet Derived Protein 4 (REG4) ELISA Kit

Sign In for Pricing
View Details
Rat 8-OHdG (8-Hydroxydeoxyguanosine) ELISA Kit
EKF58441 96 Tests

Rat 8-OHdG (8-Hydroxydeoxyguanosine) ELISA Kit

Sign In for Pricing
View Details
HSP90B1 AAV Vector (Mouse) (CMV)
23991104 1 µg

HSP90B1 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Lentiviral human COQ9 shRNA (UAS) - Lentiviral human COQ9 shRNA (UAS, GFP) (25)
GTR15333419 1 Vial

Lentiviral human COQ9 shRNA (UAS) - Lentiviral human COQ9 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Sheep Sideroflexin 1 ELISA Kit
MBS078599-01 48 Well

Sheep Sideroflexin 1 ELISA Kit

Sign In for Pricing
View Details