Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein T25D10.1 (T25D10.1)

This Recombinant Uncharacterized protein T25D10.1 (T25D10.1) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Uncharacterized protein T25D10.1

UniProt

Q10017

Expression Region

1-327

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLRRRNLNSSRIICIISIIVLLLIIISLYPHKRTQFGRYSRRQKTIRFQHSTGEIGDQL FSLLSHLGVAKTLYRIPVINSANNSKLIDTLSNAMFTRFPSILQQFLIAIEPPTAVNREL GIENSSYEDPLTKFSEDTSSSLMVKGNGFKSFKYFDNLRSDIRLWVLEDAESVLEAQNLI TKSQRNNFKICVHATLESNKNCSVKAIAQILNHYTNEYEDVMLIIASPFPEFTRFIFTNS RIRKYKTEKFSLISSSPEMQIIFSRIYCDVVFLTVPYSTHGWWMGYLAKDDNSHVFYFDP DMFPKNRTANQEDYFPPKWKKLSRKIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Amylose Separopore® 4B-CL OnePass™ Column (Epoxy-Coupled)
20170017-1 4 mL

Amylose Separopore® 4B-CL OnePass™ Column (Epoxy-Coupled)

Sign In for Pricing
View Details
ITB6 Antibody
C44300-01 50 μL

ITB6 Antibody

Sign In for Pricing
View Details
ITB6 Antibody
C44300-02 100 µL

ITB6 Antibody

Sign In for Pricing
View Details
PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)
MBS6390622-01 0.1 mL

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)

Sign In for Pricing
View Details
PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)
MBS6390622-02 5x 0.1 mL

PRKAB2 (5'-AMP-activated Protein Kinase Subunit beta-2, AMPK Subunit beta-2, MGC61468) (MaxLight 550)

Sign In for Pricing
View Details
PLLP, NT (PLLP, PMLP, TM4SF11, Plasmolipin, Plasma membrane proteolipid) (MaxLight 550) discontinued
040178-ML550 100 µL

PLLP, NT (PLLP, PMLP, TM4SF11, Plasmolipin, Plasma membrane proteolipid) (MaxLight 550) discontinued

Sign In for Pricing
View Details