Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fowlpox virus Immunodominant envelope protein p35 (FPV140)

This Recombinant Fowlpox virus Immunodominant envelope protein p35 (FPV140) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Immunodominant envelope protein p35, Ag35, Virion envelope protein p35

UniProt

Q9J590

Expression Region

1-327

Origin

Fowlpox virus (strain NVSL) (FPV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPGDKKQIIFVITTIGRPSSTVVPFKNLEVSEWSYKKGIKNGYDDYRDPPSPKPLPKSK QEPNADDKVGDIEYDEMVSVRDGYYSDVCRLTCTEDTKIFIADHISLWRYIMDNAEKLPN YVVIMEDDNTITGEGFITNLDNITKVLNDNNVDILQLVTHTKLLKDRNSQHLMLLPDLEA FKGSFDVSLSAYIIRQEAVRKLYSYFTNNKPSFDISLEILRIENTLGITRYVVDNDRYVY HDYKLANEFMKNKKNRLSIKSRIDGWIMDNWPSFYHRMYYPLFSVFGKYDITMMFLIAIV IIIGLAIFDINNKLLWLLSGVFLAYSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF680R conjugate, 0.1mg/mL
BNC810152-500 1x 500 µL

CD11c (HC1/1), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details