Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus haemolyticus UPF0365 protein SH1343 (SH1343)

This Recombinant Staphylococcus haemolyticus UPF0365 protein SH1343 (SH1343) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

UPF0365 protein SH1343

UniProt

Q4L6S3

Expression Region

1-328

Origin

Staphylococcus haemolyticus (strain JCSC1435)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGLGIIVIAVIIVIALLVLFSFVPVGLWISAIAAGVKVGIGTLVGMRLRRVSPRKVIGP LIKAHKAGLNLTTNQLESHYLAGGNVDRVVDANIAAQRADINLPFERGAAIDLAGRDVLE AVQMSVNPKVIETPFITGVAMNGIEVKAKARITVRANISRLVGGSGEETIIARVGEGIVS TIGSSEHHTQVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDIGKNIGADLQTEQALA DKNIAQAKAEERRAMAVASEQEMKARVQEMRAKVVEAESEVPLAMAEALREGNLGVKDYY NLKNVEADTGMRNAINKRTEQNEDESPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-500 1x 500 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-100 1x 100 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details