Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (nsdhl)

This Recombinant Dictyostelium discoideum Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (nsdhl) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating, EC= 1.1.1.170

UniProt

Q54L85

Expression Region

1-328

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKNVFLTGGSGFLGKYIIEELISNGYKVFALSRSETSNKVLSQMGATPVMSSLHDEQGLT EAIKGCDIVIHCAAKLETNSESVQELYKDNIDATELLFNICNQSSTSSVSVFCFISSEGV IMNGENINNATEDTPYPPIEQLGWYNKSKAISEQFLLATQSSMSRMKTIVIRLPLVWGSR DNVLDYLVGLCNKFQWFWIGGGKNYLSIVHAKNASYGIRLAIEKGDNQDIFHLTDGESVQ YRKFFTDRFKKKGVSTNKLHMVLPTPIALSLVWIMALIWKLFNLKGLPLLTKTGLIYSSK NFTINDDKARLKLGYTNKINYNQGMDEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL
BNC400257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL
BNC680034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF740 conjugate, 0.1mg/mL
BNC740151-500 1x 500 µL

CD11a (Cris-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details