Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0365 protein SAHV_1560 (SAHV_1560)

This Recombinant Staphylococcus aureus UPF0365 protein SAHV_1560 (SAHV_1560) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

UPF0365 protein SAHV_1560

UniProt

A7X2X2

Expression Region

1-329

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-100 1x 100 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-100 1x 100 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL
BNC040705-500 1x 500 µL

MART-1 / Melan-A (M2-7C10 + M2-9E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL
BNC942221-100 1x 100 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL
BNC681506-500 1x 500 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details