Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1654 (AF_1654)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1654 (AF_1654) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1654

UniProt

O28619

Expression Region

1-329

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNFKLIVRKWYIPVLIISLITLVASAYALYWATIPETKETQISIRHYSALAYFSGGAEV KKDNPIWANGSFVTLPVYSYSLTPEYSGEFYFTTAPRGDITIETEAKIVYFYEVSDAPVW EKVYYAASNTSRGEIKTNFKINVTDLKSKINEAQNSFGVYLGKTGARIDVSVHYYGKITG KDVDETLSFKIPIDVQSTYYSFSTLNETRDFEMPSTRVVEVQKPLHMKVIPAALCTVSII FAGLSVVYRTKYSDVSSLEREIERVSWEKKLKEVSFARMPETNLEMVEVERFEDISKAAE ETFEHLFYDREKGVFFFIHGGVLYYCREK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CTNNAL1 (Alpha-catulin, Alpha-catenin-related Protein, ACRP, Catenin alpha-like Protein 1, FLJ08121) (FITC)
125454-FITC 100 µL

CTNNAL1 (Alpha-catulin, Alpha-catenin-related Protein, ACRP, Catenin alpha-like Protein 1, FLJ08121) (FITC)

Sign In for Pricing
View Details
TMEM184A AAV siRNA Pooled Vector
46958161 1.0 µg

TMEM184A AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody
AMRe03296-01 1 Each

Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody
AMRe03296-02 50 µL

Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody

Sign In for Pricing
View Details
Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody
AMRe03296-03 100 µL

Phospho-Histone H3 (Ser10/Thr11) Rabbit Monoclonal antibody

Sign In for Pricing
View Details
4- (((1R,2R,4Ar,5R,8As) -2- ((3-Carboxypropanoyl) Oxy) -1,4A-Dimethyl-6-Methylene-5- ((E) -2- (2-Oxo-2,5-Dihydrofuran-3-Yl) Vinyl) Decahydronaphthalen-1-Yl) Methoxy) -4-Oxobutanoic Acid
OR1025581-01 100 mg

4- (((1R,2R,4Ar,5R,8As) -2- ((3-Carboxypropanoyl) Oxy) -1,4A-Dimethyl-6-Methylene-5- ((E) -2- (2-Oxo-2,5-Dihydrofuran-3-Yl) Vinyl) Decahydronaphthalen-1-Yl) Methoxy) -4-Oxobutanoic Acid

Sign In for Pricing
View Details