Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1654 (AF_1654)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1654 (AF_1654) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1654

UniProt

O28619

Expression Region

1-329

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNFKLIVRKWYIPVLIISLITLVASAYALYWATIPETKETQISIRHYSALAYFSGGAEV KKDNPIWANGSFVTLPVYSYSLTPEYSGEFYFTTAPRGDITIETEAKIVYFYEVSDAPVW EKVYYAASNTSRGEIKTNFKINVTDLKSKINEAQNSFGVYLGKTGARIDVSVHYYGKITG KDVDETLSFKIPIDVQSTYYSFSTLNETRDFEMPSTRVVEVQKPLHMKVIPAALCTVSII FAGLSVVYRTKYSDVSSLEREIERVSWEKKLKEVSFARMPETNLEMVEVERFEDISKAAE ETFEHLFYDREKGVFFFIHGGVLYYCREK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100a6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3413108 1.0 µg DNA

S100a6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
CHST11 Conjugated Antibody
orb1614829 100 µL

CHST11 Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1121559-01 0.02 mg (E-Coli)

Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1121559-02 0.1 mg (E-Coli)

Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1121559-03 0.02 mg (Yeast)

Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details
Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)
MBS1121559-04 0.1 mg (Yeast)

Recombinant Arthroderma otae Ubiquinone biosynthesis protein COQ4, mitochondrial (COQ4)

Sign In for Pricing
View Details