Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 68 (Tmem68)

This Recombinant Mouse Transmembrane protein 68 (Tmem68) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Transmembrane protein 68

UniProt

Q9D850

Expression Region

1-329

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQLEDYLNFANHLLWVFTPLILLILPYFT IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE GAALIIFYHGAIPIDFYYFMAKIFIQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPRE KCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIRE GFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPYDPKVTAEELAEKTKNAV QALIDKHQRIPGNIRSALLDRFHKEQKAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TMEM130 sgRNA gene knockout kit - Lentiviral human TMEM130 sgRNA gene knockout kit (25)
GTR15389466 1 Vial

Lentiviral human TMEM130 sgRNA gene knockout kit - Lentiviral human TMEM130 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Human HAAO / 3-hydroxyanthranilate 3,4-dioxygenase Recombinant Protein
R10868h 1 Each

Human HAAO / 3-hydroxyanthranilate 3,4-dioxygenase Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal CD21 Antibody (544408) [DyLight 755]
FAB4909Z 0.1 mL

Mouse Monoclonal CD21 Antibody (544408) [DyLight 755]

Sign In for Pricing
View Details
SCF, NT (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)
MBS6013659-01 0.2 mL

SCF, NT (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)

Sign In for Pricing
View Details
SCF, NT (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)
MBS6013659-02 5x 0.2 mL

SCF, NT (Kit Ligand, C-kit Ligand, Stem Cell Factor, Mast Cell Growth Factor, MGF, KITLG)

Sign In for Pricing
View Details
NELL2 antibody
70R-18844 50 μL

NELL2 antibody

Sign In for Pricing
View Details