Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 68 (Tmem68)

This Recombinant Mouse Transmembrane protein 68 (Tmem68) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Transmembrane protein 68

UniProt

Q9D850

Expression Region

1-329

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQLEDYLNFANHLLWVFTPLILLILPYFT IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE GAALIIFYHGAIPIDFYYFMAKIFIQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPRE KCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIRE GFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPYDPKVTAEELAEKTKNAV QALIDKHQRIPGNIRSALLDRFHKEQKAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Smad2 Rabbit pAb, BF700 conjugated
orb2822049 100 µL

Smad2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Human IGF2 (NM_000612) AAV Particle
RC219798A1V 250 µL

Human IGF2 (NM_000612) AAV Particle

Sign In for Pricing
View Details
Recombinant Human MAPKAPK3 (N-GST tag)
MBS4160206-01 0.01 mg

Recombinant Human MAPKAPK3 (N-GST tag)

Sign In for Pricing
View Details
Recombinant Human MAPKAPK3 (N-GST tag)
MBS4160206-02 5x 0.01 mg

Recombinant Human MAPKAPK3 (N-GST tag)

Sign In for Pricing
View Details
Hck Recombinant Protein Antigen
NBP2-57211PEP 100 µL

Hck Recombinant Protein Antigen

Sign In for Pricing
View Details
Ppp1r12b (NM_001107178) Rat Tagged ORF Clone Lentiviral Particle
RR202010L3V 200 µL

Ppp1r12b (NM_001107178) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details