Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative glycosyltransferase CsbB (csbB)

This Recombinant Bacillus subtilis Putative glycosyltransferase CsbB (csbB) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Putative glycosyltransferase CsbB, EC= 2.4.-.-

UniProt

Q45539

Expression Region

1-329

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAAT CSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVI AQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSK GLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILL LSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPH YLIKEANIPNKDLPETNELKSMRRLTKMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Toll/Interleukin 1 Receptor domain-containing adapter protein (TIRAP) Human ELISA Kit
H6717 96 Tests

Toll/Interleukin 1 Receptor domain-containing adapter protein (TIRAP) Human ELISA Kit

Sign In for Pricing
View Details
Box of 100 Glass Microfibre Filter 1.6µm, 38 Mm
FV21A0038C Box of 100

Box of 100 Glass Microfibre Filter 1.6µm, 38 Mm

Sign In for Pricing
View Details
FN1 | Fibronectin Rabbit pAb, PerCP-Cy5.5 conjugated
orb3126045 100 µL

FN1 | Fibronectin Rabbit pAb, PerCP-Cy5.5 conjugated

Sign In for Pricing
View Details
Human Neurogranin Recombinant Protein
PROTQ92686-250ug 250 µg

Human Neurogranin Recombinant Protein

Sign In for Pricing
View Details
SUN5 Antibody
orb253386 100 µL

SUN5 Antibody

Sign In for Pricing
View Details
Myosin (Skeletal, Slow) Antibody (monoclonal)
ASA-B1343 1 Each

Myosin (Skeletal, Slow) Antibody (monoclonal)

Sign In for Pricing
View Details