Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative glycosyltransferase CsbB (csbB)

This Recombinant Bacillus subtilis Putative glycosyltransferase CsbB (csbB) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

Putative glycosyltransferase CsbB, EC= 2.4.-.-

UniProt

Q45539

Expression Region

1-329

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKQGLISIIIPSYNEGYNVKLIHESLKKEFKNIHYDYEIFFINDGSVDDTLQQIKDLAAT CSRVKYISFSRNFGKEAAILAGFEHVQGEAVIVMDADLQHPTYLLKEFIKGYEEGYDQVI AQRNRKGDSFVRSLLSSMYYKFINKAVEVDLRDGVGDFRLLSRQAVNALLKLSEGNRFSK GLFCWIGFDQKIVFYENVERKNGTSKWSFSSLFNYGMDGVVSFNHKPLRLCFYTGIFILL LSIIYIIATFVKILTNGISVPGYFTIISAVLFLGGVQLLSLGIIGEYIGRIYYETKKRPH YLIKEANIPNKDLPETNELKSMRRLTKMH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Tyrosine-sulfated glycopeptide receptor 1 (PSYR1) , partial
MBS7098232 Inquire

Recombinant Arabidopsis thaliana Tyrosine-sulfated glycopeptide receptor 1 (PSYR1) , partial

Sign In for Pricing
View Details
Ub (Acetyl Lys33) Polyclonal Antibody
MBS9241359-01 0.1 mL

Ub (Acetyl Lys33) Polyclonal Antibody

Sign In for Pricing
View Details
Ub (Acetyl Lys33) Polyclonal Antibody
MBS9241359-02 5x 0.1 mL

Ub (Acetyl Lys33) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial
orb1096194-01 20 µg

Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial

Sign In for Pricing
View Details
Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial
orb1096194-02 100 µg

Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial

Sign In for Pricing
View Details
Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial
orb1096194-03 1 mg

Recombinant Human Lysyl oxidase homolog 3 (LOXL3), partial

Sign In for Pricing
View Details