Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0365 protein MW1525 (MW1525)

This Recombinant Staphylococcus aureus UPF0365 protein MW1525 (MW1525) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

UPF0365 protein MW1525

UniProt

Q8NWB3

Expression Region

1-329

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED9 sgRNA CRISPR Lentivector set (Human)
K1285301 3x 1.0 µg

MED9 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
TCP10 293 Cell Lysate
408361 0.1 mg

TCP10 293 Cell Lysate

Sign In for Pricing
View Details
Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit
MBS7246158-01 48 Well

Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit
MBS7246158-02 96 Well

Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit
MBS7246158-03 5x 96 Well

Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit
MBS7246158-04 10x 96 Well

Guinea pig Carbohyde sulfotransferase 8 (CHST8) ELISA Kit

Sign In for Pricing
View Details