Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0365 protein SAV1573 (SAV1573)

This Recombinant Staphylococcus aureus UPF0365 protein SAV1573 (SAV1573) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

UPF0365 protein SAV1573

UniProt

Q99TS3

Expression Region

1-329

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUSD6 Rabbit Polyclonal Antibody (FITC)
orb2590339 100 µg

SUSD6 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mouse Pth1r Pre-designed siRNA Set A
SI111399A 1 Each

Mouse Pth1r Pre-designed siRNA Set A

Sign In for Pricing
View Details
DUSP14 (NM_007026) Human Recombinant Protein
E45H41966M5 20 µg

DUSP14 (NM_007026) Human Recombinant Protein

Sign In for Pricing
View Details
Avil sgRNA CRISPR Lentivector set (Mouse)
K3849301 3x 1.0 µg

Avil sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)
MBS6175285-01 0.1 mL

GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)

Sign In for Pricing
View Details
GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)
MBS6175285-02 5x 0.1 mL

GUCY2D (Guanylate Cyclase 2D, Membrane (Retina-Specific), CORD5, CORD6, CYGD, GUC1A4, GUC2D, LCA, LCA1, RETGC-1, ROS-GC1, retGC) (FITC)

Sign In for Pricing
View Details