Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0365 protein SAV1573 (SAV1573)

This Recombinant Staphylococcus aureus UPF0365 protein SAV1573 (SAV1573) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

UPF0365 protein SAV1573

UniProt

Q99TS3

Expression Region

1-329

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLSFIVIAVIIIVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor I (CFI) Antibody
abx129476-01 100 µL

Complement Factor I (CFI) Antibody

Sign In for Pricing
View Details
Complement Factor I (CFI) Antibody
abx129476-02 200 µL

Complement Factor I (CFI) Antibody

Sign In for Pricing
View Details
Complement Factor I (CFI) Antibody
abx129476-03 1 mL

Complement Factor I (CFI) Antibody

Sign In for Pricing
View Details
Lentiviral mouse Poc5 shRNA (UAS) - Lentiviral mouse Poc5 shRNA (UAS) (25)
GTR15189521 1 Vial

Lentiviral mouse Poc5 shRNA (UAS) - Lentiviral mouse Poc5 shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-Human CD44 Antibody (VFF-18), FITC
MBS1583403-01 50 Tests

Anti-Human CD44 Antibody (VFF-18), FITC

Sign In for Pricing
View Details
Anti-Human CD44 Antibody (VFF-18), FITC
MBS1583403-02 100 Tests

Anti-Human CD44 Antibody (VFF-18), FITC

Sign In for Pricing
View Details