Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter pylori 36 kDa antigen (HP_1488)

This Recombinant Helicobacter pylori 36 kDa antigen (HP_1488) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

36 kDa antigen

UniProt

P94851

Expression Region

1-329

Origin

Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNSMLDKNKAILTGGGALLLGLIVLFYLAYRPKAEVLQGFLEAREYSVSSKVPGRIEKV FVKKGDHIKKGDLVFSISSPELEAKLAQAEAGHKAAKALSDEVKRGSRDETINSARDVWQ AAKSQATLAKETYKRVQDLYDNGVASLQKRDEAYAAYESTKYNESAAYQKYKMALGGASS ESKIAAKAKESAALGQVNEVESYLKDVKATAPIDGEVSNVLLSGGELSPKGFPVVLMIDL KDSWLKISVPEKYLNEFKVGKEFEGYIPALKKSTKFRVKYLSVMGDFATWKATNNSNTYD MKSYEVEAIPLEELENFRVGMSVLVTIKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL
BNC740257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL
BNC681150-500 1x 500 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL
BNC881468-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1468), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details