Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Stomatin-1 (sto-1)

This Recombinant Stomatin-1 (sto-1) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Stomatin-1

UniProt

Q19200

Expression Region

1-330

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPSETVEMQEMAQPSGQQRDVEARVQSAPANHSHDAGCTEMFCIAMSYVLIFLTFPVSV FMCIKIVQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNIDLRVASYNVPSQEILSR DSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKIS ADMKISLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKIIAAEGELRAS AALAEAATIISKSEGAMQLRYLHTLNAISSEKTSTIIFPFPMEILGGISKVGSGGTSQNF PVQEMMNAALQSIQRQDTVPATASSSGSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eg5 Peptide
AF4745-BP 1 mg

Eg5 Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal Caveolin-3 Antibody [DyLight 405]
NBP2-98712V 0.1 mL

Rabbit Polyclonal Caveolin-3 Antibody [DyLight 405]

Sign In for Pricing
View Details
HTRA1 Human shRNA Lentiviral Particle (Locus ID 5654)
TL316674V 500 µL Each

HTRA1 Human shRNA Lentiviral Particle (Locus ID 5654)

Sign In for Pricing
View Details
CLK3 Protein Lysate (Mouse) with C-HA Tag
16354034 100 µg

CLK3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
ANTXR1, Phosphorylated (Tyr382) (Anthrax Toxin Receptor 1, Tumor Endothelial Marker 8, ATR, TEM8) (MaxLight 650)
MBS6463326-01 0.1 mL

ANTXR1, Phosphorylated (Tyr382) (Anthrax Toxin Receptor 1, Tumor Endothelial Marker 8, ATR, TEM8) (MaxLight 650)

Sign In for Pricing
View Details
ANTXR1, Phosphorylated (Tyr382) (Anthrax Toxin Receptor 1, Tumor Endothelial Marker 8, ATR, TEM8) (MaxLight 650)
MBS6463326-02 5x 0.1 mL

ANTXR1, Phosphorylated (Tyr382) (Anthrax Toxin Receptor 1, Tumor Endothelial Marker 8, ATR, TEM8) (MaxLight 650)

Sign In for Pricing
View Details