Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA)

This Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

UPF0365 protein yqfA

UniProt

P54466

Expression Region

1-331

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFTLVGMRLRRVIPNRVV NPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIELTFERCAAIDLAGRDV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERLVGGAGEETIVARVGEGI VSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD YMNIKNIDADTEMRDSFGKLTKDPSDEDRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABPB2 (GABPB1) (NM_002041) Human Over-expression Lysate
LY419570 100 µg

GABPB2 (GABPB1) (NM_002041) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LRRC10B activation kit by CRISPRa
GA118136 1 Kit

Human LRRC10B activation kit by CRISPRa

Sign In for Pricing
View Details
Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit
E-EL-H0836-01 24 Tests

Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit
E-EL-H0836-02 48 Tests

Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit
E-EL-H0836-03 96 Tests

Human NTXI (Cross Linked N-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Chchd4 (NM_133928) Mouse Tagged ORF Clone
MG200873 10 µg

Chchd4 (NM_133928) Mouse Tagged ORF Clone

Sign In for Pricing
View Details