Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA)

This Recombinant Bacillus subtilis UPF0365 protein yqfA (yqfA) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

UPF0365 protein yqfA

UniProt

P54466

Expression Region

1-331

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPSTLMILAIVAVAIIVLAVFFTFVPVMLWISALAAGVKISIFTLVGMRLRRVIPNRVV NPLIKAHKAGLNVGTNQLESHYLAGGNVDRVVNALIAAQRANIELTFERCAAIDLAGRDV LEAVQMSVNPKVIETPFIAGVAMDGIEVKAKARITVRANIERLVGGAGEETIVARVGEGI VSTIGSSDNHKKVLENPDMISQTVLGKGLDSGTAFEILSIDIADVDIGKNIGAILQTDQA EADKNIAQAKAEERRAMAVAQEQEMRARVEEMRAKVVEAEAEVPLAMAEALREGNIGVMD YMNIKNIDADTEMRDSFGKLTKDPSDEDRKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Macaca nemestrina PCSK9/Proprotein Convertase 9 Protein (His Tag)
PKSQ050064-01 10 µg

Recombinant Macaca nemestrina PCSK9/Proprotein Convertase 9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Macaca nemestrina PCSK9/Proprotein Convertase 9 Protein (His Tag)
PKSQ050064-02 50 µg

Recombinant Macaca nemestrina PCSK9/Proprotein Convertase 9 Protein (His Tag)

Sign In for Pricing
View Details
Human CD62L Recombinant Rabbit monoclonal Antibody
HA723576 100 µL

Human CD62L Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SPINT1 Antibody
KC-18798-01 50 μL

SPINT1 Antibody

Sign In for Pricing
View Details
SPINT1 Antibody
KC-18798-02 100 µL

SPINT1 Antibody

Sign In for Pricing
View Details
SPINT1 Antibody
KC-18798-03 1 mL

SPINT1 Antibody

Sign In for Pricing
View Details