Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum Protein HflC (hflC)

This Recombinant Treponema pallidum Protein HflC (hflC) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Protein HflC, EC= 3.4.-.-

UniProt

O83152

Expression Region

1-331

Origin

Treponema pallidum (strain Nichols)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKRGLQVHARVRPVLNIGIVVGVLLGGVVLLQPFYLIQEGQVALITQFGEIIKTNNTAG LYVRAPFLHHVHKYTAKLLRVDGDPQKIPTKEKQFIEVDTTSRWRIEDVKKFYQSLGTYE AAYSRISDIIDSSVRDIITVNGLDDVVRSTNAINESNHSEQFDVPVSQLAFDRGAEKTAH MTIEKGRESLAREISQAANDQLKDFGIVVVDVIFKGIKYSDELQASVFNRMVKERNQIAQ MFRSTGEGKKAEWLGKLDNEKRSLLSKAYEEAERIKGEADARAAAVYAQSYGKSPEFYGF WKSLEVYKKSLPDTEKILSTDLEYFKHLYQH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIB Antibody
KC-3787-01 50 μL

PPIB Antibody

Sign In for Pricing
View Details
PPIB Antibody
KC-3787-02 100 µL

PPIB Antibody

Sign In for Pricing
View Details
PPIB Antibody
KC-3787-03 1 mL

PPIB Antibody

Sign In for Pricing
View Details
TentaGel® MB CHO
MB160006.1G 1 g

TentaGel® MB CHO

Sign In for Pricing
View Details
ARL8A (NM_138795) Human Over-expression Lysate
LY403368 100 µg

ARL8A (NM_138795) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD163 Antibody[S15049F]
E-AB-F1295M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD163 Antibody[S15049F]

Sign In for Pricing
View Details