Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Transmembrane protein 68 (TMEM68)

This Recombinant Chicken Transmembrane protein 68 (TMEM68) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Transmembrane protein 68

UniProt

Q5ZJD8

Expression Region

1-332

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIGSNESSTEGPIPTSYLSFLAYLLGEWTGVEHTEDYLSYGAYLSWVLFPLAIVFILPVA IFFFCFNTSLLLLHIYKRRKNGFNEGHSGDVWYGAKEMLVNLWDGHGRVWHGYELHGDEN IPEVPALIVFYHGASPVDYLYFMARLLIRRKRYCHVVADHFVFRLPGLKMFIEVLGVMHG PKEVCVSALKKGYLLAISPGGVREALFSDETYAIMWGNRKGFAQVAIDAKVPIIPMFTQN VREGIRTLGGIKIFRKLYERIRLPIVPMYGWFPVKFRTFIGEPIPYDPNITAEELTAKTK AALQALITKHQKIPGNILRALMERFQTRQKED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392H-01 20 Tests

PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392H-02 100 Tests

PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]
E-AB-F1392H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD195/CCR5 Antibody[HEK/1/85a]

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-01 50 μL

ABI2 Antibody

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-02 100 µL

ABI2 Antibody

Sign In for Pricing
View Details
ABI2 Antibody
KC-48309-03 1 mL

ABI2 Antibody

Sign In for Pricing
View Details