Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0365 protein STH520 (STH520)

This Recombinant UPF0365 protein STH520 (STH520) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

UPF0365 protein STH520

UniProt

Q67S38

Expression Region

1-332

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSMPGLGYLILTFVVLLLLVLFFSFVPVGLWISAAAADVRVGIFYMIGMKLRRVPPHRIV NALIKAEKAGLEISIDKLEAHYLAGGNVDRVIDALIAAQRAGIDLVFERAAAIDLAGRNV LEAVQMSVNPKVIETPVVAGVAQDGIELRAKARVTVRADINRLVGGAGEDTIIARVGEGV VSTIGSAASHKEVLENPDMISRTVLAKGLDAGTAFEIVSIDIADVDVGANIGARLRADQA EAEKVMAQAKAEERRAMAVAEEQEMRAETQRMRAKVVEAEAEVPRALAQALREGRIGVME YLMMQNLQADTAMREALGGGQRGGQPGGQDQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL
BNC741038-100 1x 100 µL

CD45RA (111-1C5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF405S conjugate, 0.1mg/mL
BNC041171-100 1x 100 µL

CD34 (HPCA1/1171), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5), CF740 conjugate, 0.1mg/mL
BNC740527-500 1x 500 µL

Nucleolin (364-5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (C68/684 + KP1), CF488A conjugate, 0.1mg/mL
BNC880685-500 1x 500 µL

CD68 (C68/684 + KP1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WIPI2 (2A2), CF568 conjugate, 0.1mg/mL
BNC682904-500 1x 500 µL

WIPI2 (2A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details