Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sulfolobus islandicus filamentous virus Uncharacterized protein 53 (SIFV0053)

This Recombinant Sulfolobus islandicus filamentous virus Uncharacterized protein 53 (SIFV0053) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Uncharacterized protein 53

UniProt

Q914H9

Expression Region

1-332

Origin

Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) (SIFV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLKLVEISSIIRGGANIYVNNKLVATTHNNVTPSFILSLIKSIIGVSAIYGGYFEMPST ATAKLFYKNTPVTSAVLSHTSFTEETISGYEHTRIIFTFSDASRTKYSFDSLQLWTASTH ALLSHVSDIALTSPLKKNPQDVVQIDWWIEMESGQPFANILSYLQQQQATYCTSSCTIPS VVPNMVYGYSVFNAFFILLALPNVIQVARDIKTPLTNYLVEGLTLASQVKPQGITSVICY DVCNCQMTTNPQQGTVSEFIGDNYVYVAFNFNNPCPSSEYVVPISTLDLGNGYELQFAVA GVPSNGTGASALLIKIPYGKATLKNLFTHQGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-100 1x 100 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF640R conjugate, 0.1mg/mL
BNC400338-500 1x 500 µL

P53 (PAb122), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF594 conjugate, 0.1mg/mL
BNC940851-100 1x 100 µL

HSP60 (LK1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL
BNC680266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details