Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2)

This Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

GLIPR1-like protein 2

UniProt

Q9CQ35

Expression Region

1-332

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brilliant Violet 421™ anti-human CD4
GT13907 25 Tests

Brilliant Violet 421™ anti-human CD4

Sign In for Pricing
View Details
RIN2 (NM_018993) Human Tagged ORF Clone
RG213759 10 µg

RIN2 (NM_018993) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tsku (NM_001168539) Mouse Tagged ORF Clone Lentiviral Particle
MR219129L4V 200 µL

Tsku (NM_001168539) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nr0b2 (NM_011850) Mouse Tagged Lenti ORF Clone
MR203385L4 10 µg

Nr0b2 (NM_011850) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Guinea Pig Thyroid transcription factor 1 ELISA kit
GTR10407508 96 Well

Guinea Pig Thyroid transcription factor 1 ELISA kit

Sign In for Pricing
View Details
Chicken AP 1 complex subunit β 1 (AP1B1) ELISA kit
GTR10419071 96 Well

Chicken AP 1 complex subunit β 1 (AP1B1) ELISA kit

Sign In for Pricing
View Details