Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2)

This Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

GLIPR1-like protein 2

UniProt

Q9CQ35

Expression Region

1-332

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cruz Tag 41™ (CZ-C) Alexa Fluor® 488
sc-8055 AF488 200 µg/mL

Cruz Tag 41™ (CZ-C) Alexa Fluor® 488

Sign In for Pricing
View Details
Reagecon 4 NTU Non Ratio Turbidity Standard
CRS-4-100 100 mL

Reagecon 4 NTU Non Ratio Turbidity Standard

Sign In for Pricing
View Details
Frataxin Antibody / FXN
orb534290-01 20 µg

Frataxin Antibody / FXN

Sign In for Pricing
View Details
Frataxin Antibody / FXN
orb534290-02 100 µg

Frataxin Antibody / FXN

Sign In for Pricing
View Details
NR1D1 (NM_021724) Human Tagged Lenti ORF Clone
RC208915L2 10 µg

NR1D1 (NM_021724) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ras Antibody, mAb, Rabbit
A02931-100 100 µL

Ras Antibody, mAb, Rabbit

Sign In for Pricing
View Details