Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2)

This Recombinant Mouse GLIPR1-like protein 2 (Glipr1l2) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

GLIPR1-like protein 2

UniProt

Q9CQ35

Expression Region

1-332

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKASLPWSVVWRAQSNYVRLRRVLKLCELWLLLVGSGLNAKLPLEEDVDFINEYVGLHNE LRGTVFPPGVNLRFMTWDVALSRTARAWGKKCMYSRNTHLDKLHESHPVFTEIGENMWVG PVEDFTVTTAIRSWHEERKSYSYLNDTCVEDQNCSHYIQLVWDSSYKVGCAVTSCARAGG FTHAALFICNYAPGGTLTRRPYQAGQFCSRCGPGDQCTDYLCSNTVRDEATYYQFWYPPW EKPRPVVCNPMCIFILFLRVASLLLCVIVVLIVQSRFPVILMETPTIISAEEEGKTEVEI VMEEGEGEGEGGEGEGEGEEKEEEEMLEEDEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1064 Rat siRNA Oligo Duplex (Locus ID 405966)
SR512284 1 Kit

Olr1064 Rat siRNA Oligo Duplex (Locus ID 405966)

Sign In for Pricing
View Details
Rotavirus VP6 (APC)
MBS6127109-01 0.1 mL

Rotavirus VP6 (APC)

Sign In for Pricing
View Details
Rotavirus VP6 (APC)
MBS6127109-02 5x 0.1 mL

Rotavirus VP6 (APC)

Sign In for Pricing
View Details
Horse Fructosamine-3-Kinase ELISA Kit
MBS070650-01 48 Well

Horse Fructosamine-3-Kinase ELISA Kit

Sign In for Pricing
View Details
Horse Fructosamine-3-Kinase ELISA Kit
MBS070650-02 96 Well

Horse Fructosamine-3-Kinase ELISA Kit

Sign In for Pricing
View Details
Horse Fructosamine-3-Kinase ELISA Kit
MBS070650-03 5x 96 Well

Horse Fructosamine-3-Kinase ELISA Kit

Sign In for Pricing
View Details